Home » Research Products » Recombinant Proteins » Mouse IL-33

Mouse IL-33

Product Code: 41750

 

Origin:

Recombinant

Cat. No.:

41750

Tag:

No T

Size:

0.1 mg

Source:

E.coli

Purity:

>90%

Other Names:

IL-33, IL-1F11

Species:

Mouse

 

 

Description

Expressed in E.coli with total 160 AA. Mw: 17.7 kDa (calculated). 
No tag, but with 2 extra AA at N-terminal (highlighted).

Recombinant antigen for research use or manufacturing only.

 

Introduction to the Molecule

IL-33 was identified based on sequence and structural homology with IL-1 family cytokines. The N-terminal portion of full-length IL-33 contains a predicted bipartite nuclear localization sequence and a homeodomain-like helix-turn-helix DNA binding domain. The C-terminal fragment, corresponding to mature IL-33, binds and triggers signaling through mast cell IL-1 R4/ST2L, a longtime orphan receptor involved in the augmentation of Th2 cell responses. A ternary signaling complex is formed by the subsequent association of IL-33 and ST2L with IL-1R AcP. Stimulation of Th2 polarized lymphocytes with mature IL-33 in vitro induces IL-5 and IL-13 secretion. In vivo administration of mature IL-33 promotes increased production of IL-5, IL-13, IgE, and IgA, as well as splenomegaly and inflammatory infiltration of mucosal tissues.  

 

Amino Acid Sequence

GASIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI

 

Endotoxin Level

<0.2 EU per 1 μg of the protein by the LAL method.

 

Applications

ELISA and Western Blotting.


Formulation

Lyophilized at 1 mg/mL in PBS.

 

Reconstitution

Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the lyophilized pellet dissolve completely.

 

Storage

Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.  Avoid repeated freezing/thawing cycles.

 

Quality Control Test

BCA to determine the quantity of the protein.

SDS PAGE to determine the purity of the protein.

 

SDS-PAGE Gel

 

 

 

 

Contact Us

 

Address:

 

5/F, Biotech Centre 2, No. 11 Science Park West Avenue, 

Hong Kong Science Park, Shatin, N.T., Hong Kong

Email: 

info@immunodiagnostics.com.hk      sales@immunodiagnostics.com.hk

Phone:

(+852) 3502 2780    

Fax:  

(+852)  3502 2781

 

Write a review

Your Name:


Your Review: Note: HTML is not translated!

Rating: Bad           Good

Enter the code in the box below: