Home » Research Products » Recombinant Proteins » Human FGF-19

Human FGF-19

Product Code: 41284

 

Origin:

Recombinant

Cat. No.:

41284

Tag:

N-terminal 6xHis

Size:

0.1 mg

Source:

E.coli

Purity:

>90%

Other Names:

FGF-19

Species:

Human

 

 

Description

Expressed in E.coli cells with total 217 AA. Mw: 24.5 kDa (calculated). 

C-terminal 6xHis-tag, 25 extra AA (highlighted).

Recombinant antigen for research use or manufacturing only.

 

Introduction to the Molecule

Fibroblast growth factor 19 (FGF-19) is a member of a subfamily of FGFs that includes FGF-21 and FGF-23, each member functions as an important regular of nutrient metabolism. The primary source of endocrine FGF-19 is the ileum, bile acids release into the intestine after a meal to induce expression of FGF-19. Circulating FGF-19 plays an important role in maintaining proper bile acid homeostasis. Several pharmacologic studies in hyperglycaemic, obese animal models have shown that FGF-19 can improve metabolic rate and lower serum glucose and hepatic triglyceride and cholesterol levels. Like insulin, FGF-19 functions as postprandial hormone to govern hepatic protein synthesis, glycogen synthesis and gluconeogenesis, but does not stimulate lipogenesis.  

 

Amino Acid Sequence

MSYYHHHHHHDYDIPTTENLYFQGALAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

 

Endotoxin Level

<0.2 EU per 1 μg of the protein by the LAL method.

 

Applications

ELISA and Western Blotting.


Formulation

Lyophilized at 1 mg/mL in storage buffer (50mM Tris, 300-500mM NaCl, 10% Glycerol, PH8.0).

 

Reconstitution

Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the lyophilized pellet dissolve completely.

 

Storage

Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.  Avoid repeated freezing/thawing cycles.

 

Quality Control Test

BCA to determine the quantity of the protein.

SDS PAGE to determine the purity of the protein.

 

SDS-PAGE Gel

 

 

 

 

Contact Us

 

Address:

 

5/F, Biotech Centre 2, No. 11 Science Park West Avenue, 

Hong Kong Science Park, Shatin, N.T., Hong Kong

Email: 

info@immunodiagnostics.com.hk      sales@immunodiagnostics.com.hk

Phone:

(+852) 3502 2780    

Fax:  

(+852)  3502 2781

 

Write a review

Your Name:


Your Review: Note: HTML is not translated!

Rating: Bad           Good

Enter the code in the box below: