Home » Search » Human N-terminal B-type Natriuretic Peptide (NT-proBNP)

Human N-terminal B-type Natriuretic Peptide (NT-proBNP)

Product Code: 41660

 

Origin:

Recombinant

Cat. No.:

41660

Tag:

N-terminal 6xHis

Size:

0.1 mg

Source:

E.coli

Purity:

>95%

Other names:

Amino terminal brain natriuretic peptide precursor

Species:

Human

 

Description

Expressed in E.coli with total 112 AA. Mw: 12.6 KDa (calculated).

N-terminal 6xHis-tag and TEV cleavage site, 36 extra AA (highlighted).

Recombinant antigen for research use or manufacturing only.

 

Introduction to the Molecule

N-terminal pro-brain (or B-type) natriuretic peptide (NT-proBNP) is produced predominately

by the cardiac ventricular myocytes. NT-proBNP is released in response to volume expansion

and filling pressure and is involved in maintaining intravascular volume homeostasis. Elevated

plasma levels of BNP and NT-proBNP have been observed at times of cardiac stress and damage.

 

Amino Acid Sequence

MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHPLGSPGSASDLETSGLQEQRNHLQG

KLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPR

 

Endotoxin Level

<0.2 EU/ug.

 

Applications

Standard ELISA test, Western Blot.

 

Formulation

Lyophilized at 1 mg/mL in PBS.

 

Reconstitution

Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the

lyophilized pellet dissolve completely.

 

Storage

Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C. 

Avoid repeated freezing /thawing cycles.

 

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

 

SDS-PAGE Gel

 

 

 

 

Contact Us

 

Address:

 

5/F, Biotech Centre 2, No. 11 Science Park West Avenue, 

Hong Kong Science Park, Shatin, N.T., Hong Kong

Email: 

info@immunodiagnostics.com.hk      sales@immunodiagnostics.com.hk

Phone:

(+852) 3502 2780    

Fax:  

(+852)  3502 2781

Write a review

Your Name:


Your Review: Note: HTML is not translated!

Rating: Bad           Good

Enter the code in the box below:



Tags: NT-ProBNP