Home » Search » Human Procalcitonin (PCT)

Human Procalcitonin (PCT)

Product Code: 41670

 

Origin:

Recombinant

Cat. No.:

41670

Tag:

N-terminal 6xHis

Size:

0.1 mg

Source:

E.coli

Purity:

>90%

Other names:

PCT

Species:

Human

 

Description

Expressed in E.coli with total 152 AA. Mw: 16.9 KDa (calculated).

N-terminal 6xHis-tag and TEV cleavage site, 36 extra AA (highlighted).

Recombinant antigen for research use or manufacturing only.

 

Introduction to the Molecule

Procalcitonin is a prohormone of calcitonin. Levels of unprocessed procalcitonin rise

significantly after bacterial infection, trauma or shock. Procalcitonin is also associated with

systemic complications in humans suffering from acute pancreatitis.

 

Amino Acid Sequence

MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSAPFRSALESSPADPATLSEDEARLLLA

ALVQDYVQMKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKR

DMSSDLERDHRPHVSMPQNAN

 

Endotoxin Level

<0.2 EU/ug.

 

Applications

Standard ELISA test, Western Blot.

 

Formulation

Lyophilized at 1 mg/mL in PBS.

 

Reconstitution

Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the

lyophilized pellet dissolve completely.

 

Storage

Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C. 

Avoid repeated freezing /thawing cycles.

 

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

 

SDS-PAGE Gel

 

 

 

 

Contact Us

 

Address:

 

5/F, Biotech Centre 2, No. 11 Science Park West Avenue, 

Hong Kong Science Park, Shatin, N.T., Hong Kong

Email: 

info@immunodiagnostics.com.hk      sales@immunodiagnostics.com.hk

Phone:

(+852) 3502 2780    

Fax:  

(+852)  3502 2781

Write a review

Your Name:


Your Review: Note: HTML is not translated!

Rating: Bad           Good

Enter the code in the box below:



Tags: PCT