Home » Search » Recombinant Human Retinol Binding Protein 4 (hRBP4)

Recombinant Human Retinol Binding Protein 4 (hRBP4)

Product Code: 41060

 

Type:

Recombinant

Cat. No.:

41060

Tag:

His

Size:

0.1 mg

Source:

E.Coli

Purity:

>95%

Other names:

RBP4

Species:

Human

 

For bulk order or without FedEx acc, please contact us by email
Payable FedEx acc:

 

Introduction to the Molecule


Retinol binding protein 4(RBP4), originally known as a specific transport of retinol in blood,

is also a novel inflammatory and insulin resistance marker. Serum levels of RBP4 increased

in insulin resistant and diabetes. Studies both in human and animal suggested that serum

levels of RBP4 plays a key role in the link between obesity, insulin resistant and diabetes.

Animal experiments found that increased secretion of RBP4 might reduces insulin-dependent

glucose uptake by muscle tissue by reducing the activity of PI(3)K (phosphoinositide 3-kinase),

and increased hepatic glucose output by increasing the expression of the enzyme PEPCK.

However, whether serum RBP4 could be a biomarker of type 2 diabetes risk still remain unclear.

 

Description

Total 211 AA. Mw: 24.4 kDa (calculated). N-terminal His-tag and TEV cleavage site,

28 extra AA (highlighted).

 

Amino Acid Sequence

MSYYHHHHHHDYDIPTTENLYFQGAMGSERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQ

DNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDH

WIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYC

DGRSERNLL

 

Formulation

Lyophilized in 1 mg/mL in PBS.

 

Reconstitution

Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the

lyophilized pellet dissolve completely.

 

Storage

Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.

Avoid repeated freezing /thawing cycles.

 

Applications

ELISA and Western blotting.

 

Quality Control Test

BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein.

 

SDS-PAGE Gel

 

 

 

 

Contact Us

 

Address:

 

5/F, Biotech Centre 2, No. 11 Science Park West Avenue,

Hong Kong Science Park, Shatin, N.T., Hong Kong

Email:

info@immunodiagnostics.com.hk      sales@immunodiagnostics.com.hk

Phone:

(+852) 3502 2780

Fax:

(+852)  3502 2781

Write a review

Your Name:


Your Review: Note: HTML is not translated!

Rating: Bad           Good

Enter the code in the box below:



Tags: hRBP4