Home » Search » Recombinant Adiponectin with Flag Tag (Human)

Recombinant Adiponectin with Flag Tag (Human)

Recombinant Adiponectin with Flag Tag (Human)
Product Code: 41013

 

Type:

Recombinant

Cat. No.:

41013

Tag:

Flag

Size:

0.1 mg

Source:

HEK293

Purity:

>98%

Other names:

Acrp30, GBP28, AdipoQ

Species:

Human

 

For bulk order or without FedEx acc, please contact us by email
Payable FedEx acc:

 

Introduction to the Molecule

 

Adiponectin is an adipokine exclusively expressed in adipose tissues with potent anti-diabetic, anti-atherogenic and anti-inflammatory functions.
In humans, decreased serum adiponectin levels are associated with increased body mass index (BMI), decreased insulin sensitivity, less favourable plasma lipid profiles, increased inflammation and increased risk for the development of type 2 diabetes, hypertension and coronary heart diseases.

 

Description

Total 234 AA. Mw: 25.5kDa (calculated). C-terminal flag-tag, 8 extra AA(highlighted).

 

Amino Acid Sequence

ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGV

PGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNI

PGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGE

RNGLYADNDNDSTFTGFLLYHDTNDYKDDDDK

 

Formulation

Lyophilized in 1 mg/mL in PBS.

 

Endotoxin Level

<0.2 EU/ug.

 

Reconstitution

Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let

the lyophilized pellet dissolve completely.

 

Storage

Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.

Avoid repeated freezing /thawing cycles.

 

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

 

Applications

Cell culture, ELISA and Western blotting.

 

SDS-PAGE Gel

 

 

 

 

Contact Us

 

Address:

 

5/F, Biotech Centre 2, No. 11 Science Park West Avenue,

Hong Kong Science Park, Shatin, N.T., Hong Kong

Email:

info@immunodiagnostics.com.hk      sales@immunodiagnostics.com.hk

Phone:

(+852) 3502 2780

Fax:

(+852)  3502 2781

Write a review

Your Name:


Your Review: Note: HTML is not translated!

Rating: Bad           Good

Enter the code in the box below: