Home » Search » Mouse Interleukin-4 (IL-4)

Mouse Interleukin-4 (IL-4)

Product Code: 41370

 

Origin:

Recombinant

Cat. No.:

41370

Tag:

N-terminal 6xHis

Size:

0.1 mg

Source:

E.coli

Purity:

>95%

Other names:

IL-4

Species:

Mouse

       

 

 

Description

Expressed in E.coli with total 169 AA. Mw: 18.5 KDa (calculated).

N-terminal 6xHis-tag and TEV cleavage site, 30 extra AA (highlighted).

Recombinant antigen for research use or manufacturing only.

 

Introduction to the Molecule

Interleukin-4 (IL-4), also known as B cell-stimulatory factor-1, is a monomeric, approximately

13 kDa ‑ 18 kDa Th2 cytokine that shows pleiotropic effects during immune responses. It is a

glycosylated polypeptide that contains three intrachain disulfide bridges and adopts a bundled

four alpha -helix structure. IL-4 is primarily expressed by Th2-biased CD4+ T cells, mast cells,

basophils, and eosinophils. It promotes cell proliferation, survival, and immunoglobulin class

switch to IgG4 and IgE in human B cells, acquisition of the Th2 phenotype by naïve CD4+ T cells,

priming and chemotaxis of mast cells, eosinophils, and basophils, and the proliferation and

activation of epithelial cells.

 

Amino Acid Sequence

MSYYHHHHHHDYDIPTTENLYFQGAMGSGIHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTE

KETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLEN

FLERLKTIMREKYSKCSS

 

Endotoxin Level

<0.2 EU/ug.

 

Applications

Standard ELISA test, Western Blot.

 

Formulation

Lyophilized at 1 mg/mL in NaCl 500mM, KCl 2.7mM, Na2HPO4 10mM, KH2PO4 1.8mM, pH 7.0.

 

Reconstitution

Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the

lyophilized pellet dissolve completely.

 

Storage

Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C. 

Avoid repeated freezing /thawing cycles.

 

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

 

SDS-PAGE Gel

 

 

 

 

Contact Us

 

Address:

 

5/F, Biotech Centre 2, No. 11 Science Park West Avenue, 

Hong Kong Science Park, Shatin, N.T., Hong Kong

Email: 

info@immunodiagnostics.com.hk      sales@immunodiagnostics.com.hk

Phone:

(+852) 3502 2780    

Fax:  

(+852)  3502 2781

Write a review

Your Name:


Your Review: Note: HTML is not translated!

Rating: Bad           Good

Enter the code in the box below:



Tags: IL-4