Home » Search » Mouse Interleukin-13 (IL-13)

Mouse Interleukin-13 (IL-13)

Product Code: 41360

 

Origin:

Recombinant

Cat. No.:

41360

Tag:

N-terminal 6xHis

Size:

0.1 mg

Source:

E.coli

Purity:

>95%

Other names:

IL-13

Species:

Mouse

       

 

Files: Data Sheet(PDF)

 

Description

Expressed in E.coli with total 142 AA. Mw: 15.9 KDa (calculated).

N-terminal 6xHis-tag and TEV cleavage site, 30 extra AA (highlighted).

Recombinant antigen for research use or manufacturing only.

 

Introduction to the Molecule

Interleukin-13 (IL-13) is a monomeric 17 kDa immunoregulatory cytokine that plays a key role

in the pathogenesis of allergy, cancer, and tissue fibrosis. It is secreted by several helper T cell

subsets, NK cells, mast cells, eosinophils, basophils, and visceral smooth muscle cells. IL-13

suppresses the production of proinflammatory cytokines and other cytotoxic substances by

macrophages, fibroblasts, and endothelial cells. On B cells, it promotes cellular activation,

immunoglobulin class switching to IgE, and the up‑regulation of CD23/Fc epsilon RII.

 

Amino Acid Sequence

MSYYHHHHHHDYDIPTTENLYFQGAMGSGIGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSI

NLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLF

REGRFN

 

Endotoxin Level

<0.2 EU/ug.

 

Applications

Standard ELISA test, Western Blot.

 

Formulation

Lyophilized at 1 mg/mL in NaCl 500mM, KCl 2.7mM, Na2HPO4 10mM, KH2PO4 1.8mM, pH 7.0.

 

Reconstitution

Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the

lyophilized pellet dissolve completely.

 

Storage

Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C. 

Avoid repeated freezing /thawing cycles.

 

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

 

SDS-PAGE Gel

 

 

 

 

Contact Us

 

Address:

 

5/F, Biotech Centre 2, No. 11 Science Park West Avenue, 

Hong Kong Science Park, Shatin, N.T., Hong Kong

Email: 

info@immunodiagnostics.com.hk      sales@immunodiagnostics.com.hk

Phone:

(+852) 3502 2780    

Fax:  

(+852)  3502 2781

Write a review

Your Name:


Your Review: Note: HTML is not translated!

Rating: Bad           Good

Enter the code in the box below:



Tags: IL-13