Home » Search » Recombinant Mouse Lipocalin 2 (mLCN2)

Recombinant Mouse Lipocalin 2 (mLCN2)

Product Code: 42050

 

Type:

Recombinant

Cat. No.:

42050

Tag:

His

Size:

0.1 mg

Source:

E.Coli

Purity:

>95%

Other names:

24p3; MSFI; NGAL; LCN2

Species:

Mouse

 

For bulk order or without FedEx acc, please contact us by email
Payable FedEx acc:

 

Introduction to the Molecule

associated with obesity, insulin resistance, and hyperglycemia in humans.

 

Description

 

Lipocalin-2, also known as neutrophil gelatinase-associated lipocalin (NGAL), 24p3, siderocalin, or neutrophil lipocalin (NL), is a secretory glycoprotein  expressed in liver, lung, kidney, adipocytes, activated neutrophils and macrophages.
Lipocalin-2 is upregulated under various inflammation and infection conditions and can be served as a sensitive biomarker for various renal injuries. Serum levels of lipocalin-2 are positively correlated with obesity, insulin resistance, hyperglycemia, coronary heart disease and fatty liver disease in humans.


 

 

 Amino Acid Sequence

MSYYHHHHHHDYDIPTTENLYFQGAMGSQDSTQNLIPAPSLLTVPLQPDFRSDQFRGRWYVVGLA

GNAVQKKTEGSFTMYSTIYELQENNSYNVTSILVRDQDQGCRYWIRTFVPSSRAGQFTLGNMHRYPQV

QSYNVQVATTDYNQFAMVFFRKTSENKQYFKITLYGRTKELSPELKERFTRFAKSLGLKDDNIIFSVPTDQ

CIDN

 

Formulation

Lyophilized in 1 mg/mL in PBS.

 

Reconstitution

Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let

the lyophilized pellet dissolve completely.

 

Storage

Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.

Avoid repeated freezing /thawing cycles.

 

Applications

ELISA and Western blotting.

 

Quality Control Test

BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein.

 

SDS-PAGE Gel

 

Publications Citing Our Products:

 

Ye, Dewei, et al. J Hepatol. 2017; 66(3):669.

Ye, Dewei, et al. J Hepatol. 2016; 65(5):988-997. 
 

 

 

 

 

Contact Us

 

Address:

 

5/F, Biotech Centre 2, No. 11 Science Park West Avenue,

Hong Kong Science Park, Shatin, N.T., Hong Kong

Email:

info@immunodiagnostics.com.hk      sales@immunodiagnostics.com.hk

Phone:

(+852) 3502 2780

Fax:

(+852)  3502 2781

Write a review

Your Name:


Your Review: Note: HTML is not translated!

Rating: Bad           Good

Enter the code in the box below: