Home » Search » Recombinant Mouse Major urinary protein-1 (mMUP-1)

Recombinant Mouse Major urinary protein-1 (mMUP-1)

Product Code: 42150

 

Type:

Recombinant

Cat. No.:

42150

Tag:

His

Size:

0.1 mg

Source:

E.Coli

Purity:

>95%

Other names:

Mup7, Up-1, Ltn-1, Mup-1, Mup-a, Mup10, Lvtn-1

Species:

Mouse

 

For bulk order or without FedEx acc, please contact us by email
Payable FedEx acc:

 

Introduction

Major urinary protein 1 (Mup1), also known as Mup7, Up-1, Ltn-1, Mup-1, Mup-a, Mup10

and Lvtn-1, is a low molecular weight secreted protein produced predominantly from the liver.

Structurally it belongs to the lipocalin family, which carries small hydrophobic ligands such

as pheromones. Mup1 is an important player in regulating energy expenditure and metabolism

in mice, and its deficiency might contribute to the metabolic dysregulation in obese/diabetic mice.

 

Description

Total 190 AA. Mw: 22 KDa (calculated). N-terminal His-tag and TEV cleavage site,

28 extra AA (highlighted).

 

Amino Acid Sequence

MSYYHHHHHHDYDIPTTENLYFQGAMGSEEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRL

FLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGE

TFQLMGLYGREPDLSSDIKERFAQLCEKHGILRENIIDLSNANRCLQARE

 

Formulation

Lyophilized in PBS.

 

Reconstitution

Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the

lyophilized pellet dissolve completely.

 

Storage

Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.

Avoid repeated freezing /thawing cycles.

 

Quality Control Test

BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein.

 

Applications

ELISA and Western blotting.

 

SDS-PAGE Gel                       

 

 

 

 

Contact Us

 

Address:

 

5/F, Biotech Centre 2, No. 11 Science Park West Avenue,

Hong Kong Science Park, Shatin, N.T., Hong Kong

Email:

info@immunodiagnostics.com.hk      sales@immunodiagnostics.com.hk

Phone:

(+852) 3502 2780

Fax:

(+852)  3502 2781

Write a review

Your Name:


Your Review: Note: HTML is not translated!

Rating: Bad           Good

Enter the code in the box below:



Tags: MUP1