Home » Search » Recombinant Human Fibroblast Growth Factor-21 without Tag

Recombinant Human Fibroblast Growth Factor-21 without Tag

Product Code: 41189-01

Type:

Recombinant

Cat. No.:

41189-01

Tag:

None (his-tag removed)

Size:

0.1 mg

Source:

E.Coli

Purity:

>90%

Other names:

FGF21

Species:

Human

 

For bulk order or without FedEx acc, please contact us by email
Payable FedEx acc:

 

Introduction to the Molecule

 

FGF21 is a metabolic hormone mainly produced in liver. It regulates glucose and lipid metabolism through pleiotropic actions in multiple tissues, and protects against metabolic damages under various stresses.
In humans, high circulating FGF21 levels are found in obesity and multiple cardiometabolic disorders, including metabolic syndrome, type 2 diabetes, non-alcoholic fatty liver disease and coronary artery disease. Serum FGF21 is a potential biomarker for the early detection and risk prediction of these diseases.

 

Description

Total 183AA Mw: 19.5kDa (calculated). N-terminal His-tag removed, 2 extra AA left (highlighted).

 

Amino Acid Sequence

GAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGV

KTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLP

LPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

 

Formulation

Lyophilized in 1 mg/mL in PBS.

 

Reconstitution

Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the

lyophilized pellet dissolve completely.

 

Storage

Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.

Avoid repeated freezing /thawing cycles.

 

Applications


ELISA and Western blotting.

 

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

 

SDS-PAGE Gel                     

 

 

 

 

 

Contact Us

 

Address:

 

5/F, Biotech Centre 2, No. 11 Science Park West Avenue,

Hong Kong Science Park, Shatin, N.T., Hong Kong

Email:

info@immunodiagnostics.com.hk      sales@immunodiagnostics.com.hk

Phone:

(+852) 3502 2780

Fax:

(+852)  3502 2781

Write a review

Your Name:


Your Review: Note: HTML is not translated!

Rating: Bad           Good

Enter the code in the box below: