Home » Search » Recombinant Irisin without Tag (Human)

Recombinant Irisin without Tag (Human)

Product Code: 41359

 

Type:

Recombinant

Cat. No.:

41359

Tag:

Tagless (his-tag removed)

Size:

0.1 mg

Source:

E.Coli

Purity:

>95%

Other names:

Irisin

Species:

Human

 

For bulk order or without FedEx acc, please contact us by email
Payable FedEx acc:

 

Introduction to the Molecule

Exercise enhances muscular endurance and strength, calories expenditure, and prevents the

development of obesity and type 2 diabetes. These effects of exercise cannot be explained

solely by the expenditure of calories in muscle. A recent study indicated that a novel hormone,

irisin, plays an important role in the increase of total body energy expenditure by exercising muscle.

Irisin is a cleaved and secreted fragment of a membrane protein FNDC5. And its circulating

concentrations are increased after regular physical activity. Exercise induces the transcriptional

regulator PGC-1α in the skeletal myocyte, which in turn drives the production of the FNDC5.

Animal experiments suggested that irisin, cleaved form FNDC5, activates thermogenic programs

in white adipose tissue (“browning”), including mitochondrial biogenesis and the expression

of uncoupling protein 1 (UCP1), leading to mitochondrial heat production and energy expenditure.

Irisin is highly conserved across species, and exercise also increases circulating irisin concentrations

in humans. Therefore, the role of irisin in humans may be that it links physical activity to energy

metabolic homeostasis, including weight control.

 

Description

The recombinant irisin is the extracellular domain of FNDC5 (Asp16 to Thr136). Total 126 AA.

Mw: 14kDa (calculated). N-terminal His-tag removed, 5 extra AA left (highlighted).

 

Amino Acid Sequence

GAMGSDSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWD

LEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEMGRNQQLRT

 

Formulation

Lyophilized in 1 mg/mL in PBS

 

Reconstitution

Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let

the lyophilized pellet dissolve completely.

 

Storage

Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.

Avoid repeated freezing /thawing cycles.

 

Quality Control Test

BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein.

 

Applications

ELISA and Western blotting

 

SDS-PAGE Gel

 

 

 

 

Contact Us

 

Address:

 

5/F, Biotech Centre 2, No. 11 Science Park West Avenue,

Hong Kong Science Park, Shatin, N.T., Hong Kong

Email:

info@immunodiagnostics.com.hk      sales@immunodiagnostics.com.hk

Phone:

(+852) 3502 2780

Fax:

(+852)  3502 2781

Write a review

Your Name:


Your Review: Note: HTML is not translated!

Rating: Bad           Good

Enter the code in the box below: