Home » Search » Human Small Nuclear Ribonucleoprotein Sm D1 (SmD1)

Human Small Nuclear Ribonucleoprotein Sm D1 (SmD1)

Product Code: 41540

 

Origin:

Recombinant

Cat. No.:

41540

Tag:

N-terminal 6xHis

Size:

0.1 mg

Source:

Spodoptera frugiperda Sf9

Purity:

>90%

Other Names:

SmD1, snRNPD1

Species:

Human

 

Description

Expressed in insect Sf9 cells with total 143 AA. Mw: 16.2 KDa (calculated).

N-terminal 6xHis-tag and TEV cleavage site, 25 extra AA (highlighted).

Recombinant antigen for research use or manufacturing only.

 

Introduction to the Molecule

Small nuclear ribonucleoprotein complexes (abbreviated as U-snRNP) are essential for splicing of

precursor mRNA molecules. Seven different Sm proteins aggregate into a heteroheptameric protein

core, including small nuclear ribonucleoprotein Sm D1 (SmD1 or snRNPD1).

In the blood of patients with systemic lupus erythematosus, antinuclear antibodies are developed

with Sm specificity.

 

Immunological Function

As an autoantigen, SmD1 binds with IgG-type human auto-antibodies.

 

Amino Acid Sequence

MSYYHHHHHHDYDIPTTENLYFQGAKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKM

TLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR

 

Applications

Standard ELISA test, line/dot assay and microarray assay with positive/negative sera panels.

 

Formulation

Lyophilized at 1 mg/mL in storage buffer (50mM Tris, 300mM NaCl, 0.4M L-Arginine, PH8.0).

 

Reconstitution

Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the

lyophilized pellet dissolve completely.

 

Storage

Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.  Avoid

repeated freezing /thawing cycles.

 

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

 

SDS-PAGE Gel

 

 

 

 

Contact Us

 

Address:

 

5/F, Biotech Centre 2, No. 11 Science Park West Avenue, 

Hong Kong Science Park, Shatin, N.T., Hong Kong

Email: 

info@immunodiagnostics.com.hk      sales@immunodiagnostics.com.hk

Phone:

(+852) 3502 2780    

Fax:  

(+852)  3502 2781

Write a review

Your Name:


Your Review: Note: HTML is not translated!

Rating: Bad           Good

Enter the code in the box below:



Tags: SmD1