Home » Search » Human Proliferating Cell Nuclear Antigen (PCNA)

Human Proliferating Cell Nuclear Antigen (PCNA)

Product Code: 41570

 

Origin:

Recombinant

Cat. No.:

41570

Tag:

N-terminal 6xHis

Size:

0.1 mg

Source:

Spodoptera frugiperda Sf9

Purity:

>90%

Other Names:

PCNA

Species:

Human

 

Description

Expressed in insect Sf9 cells with total 285 AA. Mw: 31.7 KDa (calculated).

N-terminal 6xHis-tag and TEV cleavage site, 25 extra AA (highlighted).

Recombinant antigen for research use or manufacturing only.

 

Introduction to the Molecule

PCNA is a co-factor of DNA polymerase delta, which forms a trimer ring around a DNA double-helix

and is involved in in DNA synthesis, repair and processing, the regulation of cell cycle and even

apoptosis. Autoantibody against PCNA occurs in patients with systemic lupus with a rare specificity

(<10% of SLE patients).

 

Immunological Function

As an autoantigen, PCNA binds with IgG-type human auto-antibodies.

 

Amino Acid Sequence

MSYYHHHHHHDYDIPTTENLYFQGAFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHV

SLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEM

KLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSN

VDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS

 

Applications

Standard ELISA test, line/dot assay and microarray assay with positive/negative sera panels.

 

Formulation

Lyophilized at 1 mg/mL in storage buffer (20mM Tris, 300-500mM NaCl, 10% Glycerol, PH8.0).

 

Reconstitution

Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the

lyophilized pellet dissolve completely.

 

Storage

Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.  Avoid

repeated freezing /thawing cycles.

 

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

 

SDS-PAGE Gel

 

 

 

 

Contact Us

 

Address:

 

5/F, Biotech Centre 2, No. 11 Science Park West Avenue, 

Hong Kong Science Park, Shatin, N.T., Hong Kong

Email: 

info@immunodiagnostics.com.hk      sales@immunodiagnostics.com.hk

Phone:

(+852) 3502 2780    

Fax:  

(+852)  3502 2781

Write a review

Your Name:


Your Review: Note: HTML is not translated!

Rating: Bad           Good

Enter the code in the box below:



Tags: PCNA