Home » Search » Human Tripartite Motif Containing 21 (SSA/Ro52)

Human Tripartite Motif Containing 21 (SSA/Ro52)

Product Code: 41590

 

Origin:

Recombinant

Cat. No.:

41590

Tag:

N-terminal 6xHis

Size:

0.1 mg

Source:

Spodoptera frugiperda Sf9

Purity:

>85%

Other Names:

TRIM21, SSA/Ro52, Ro52

Species:

Human

 

Description

Expressed in insect Sf9 cells with total 499 AA. Mw: 57.1 KDa (calculated).

N-terminal 6xHis-tag and TEV cleavage site, 25 extra AA (highlighted).

Recombinant antigen for research use or manufacturing only.

 

Introduction to the Molecule

Ro/SSA ribonucleoproteins are involved in RNA quality control and cellular stress response to UV

irradiation, and comprise of a single polypeptide and four small RNA molecules including the 52 kDa

Ro protein. Ro/SSA interacts with autoantigens in patients with Sjogren syndrome and systemic

lupus erythematosus. 

 

Immunological Function

As an autoantigen, SSA/Ro52 binds with IgG-type human auto-antibodies.

 

Amino Acid Sequence

MSYYHHHHHHDYDIPTTENLYFQGAASAARLTMMWEEVTCPICLDPFVEPVSIECGHSFCQECISQVGK

GGGSVCPVCRQRFLLKNLRPNRQLANMVNNLKEISQEAREGTQGERCAVHGERLHLFCEKDGKALCWVC

AQSRKHRDHAMVPLEEAAQEYQEKLQVALGELRRKQELAEKLEVEIAIKRADWKKTVETQKSRIHAEFVQQ

KNFLVEEEQRQLQELEKDEREQLRILGEKEAKLAQQSQALQELISELDRRCHSSALELLQEVIIVLERSESWNL

KDLDITSPELRSVCHVPGLKKMLRTCAVHITLDPDTANPWLILSEDRRQVRLGDTQQSIPGNEERFDSYPM

VLGAQHFHSGKHYWEVDVTGKEAWDLGVCRDSVRRKGHFLLSSKSGFWTIWLWNKQKYEAGTYPQTP

LHLQVPPCQVGIFLDYEAGMVSFYNITDHGSLIYSFSECAFTGPLRPFFSPGFNDGGKNTAPLTLCPLNIGS

QGSTDY

 

Applications

Standard ELISA test, line/dot assay and microarray assay with positive/negative sera panels.

 

Formulation

Lyophilized at 1 mg/mL in storage buffer (50mM Tris, 300-500mM NaCl, 10% Glycerol, PH8.0).

 

Reconstitution

Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the

lyophilized pellet dissolve completely.

 

Storage

Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.  Avoid

repeated freezing /thawing cycles.

 

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

 

SDS-PAGE Gel

 

 

 

 

Contact Us

 

Address:

 

5/F, Biotech Centre 2, No. 11 Science Park West Avenue, 

Hong Kong Science Park, Shatin, N.T., Hong Kong

Email: 

info@immunodiagnostics.com.hk      sales@immunodiagnostics.com.hk

Phone:

(+852) 3502 2780    

Fax:  

(+852)  3502 2781

Write a review

Your Name:


Your Review: Note: HTML is not translated!

Rating: Bad           Good

Enter the code in the box below:



Tags: Ro52