Home » Search » Human Centromere Protein B (CENPB)

Human Centromere Protein B (CENPB)

Product Code: 41620

 

Origin:

Recombinant

Cat. No.:

41620

Tag:

N-terminal 6xHis

Size:

0.1 mg

Source:

Spodoptera frugiperda Sf9

Purity:

>90%

Other Names:

CENPB

Species:

Human

 

Description

Expressed in insect Sf9 cells with total 623 AA. Mw: 68.1 KDa (calculated).

N-terminal 6xHis-tag and TEV cleavage site, 25 extra AA (highlighted).

Recombinant antigen for research use or manufacturing only.

 

Introduction to the Molecule

Centromere proteins are a group of proteins which form and/or mediate the function of

centromeres, the central structures of chromosomes to which spindle fibers/microtubuli attach

and pull the chromosomes apart in cell division. The centromere protein B (CENPB) is one

of them.

CENPB is a DNA-binding protein derived from transposases of the pogo DNA transposon

family and plays an important role in the assembly of specific centromere structures in interphase

nuclei and on mitotic chromosomes. CENPB is the most important centromeric autoantigens and

auantibodies against CENPB are present in the sera of up to 80% of patients with CREST syndrome.

 

Immunological Function

As an autoantigen, CENP-B binds with IgG-type human auto-antibodies.

 

Amino Acid Sequence

MSYYHHHHHHDYDIPTTENLYFQGAGPKRRQLTFREKSRIIQEVEENPDLRKGEIARRFNIPPSTLSTILK

NKRAILASERKYGVASTCRKTNKLSPYDKLEGLLIAWFQQIRAAGLPVKGIILKEKALRIAEELGMDDFTASN

GWLDRFRRRHGVVSCSGVARARARNAAPRTPAAPASPAAVPSEGSGGSTTGWRAREEQPPSVAEGYAS

QDVFSATETSLWYDFLPDQAAGLCGGDGRPRQATQRLSVLLCANADGSEKLPPLVAGKSAKPRAGQAGL

PCDYTANSKGGVTTQALAKYLKALDTRMAAESRRVLLLAGRLAAQSLDTSGLRHVQLAFFPPGTVHPLER

GVVQQVKGHYRQAMLLKAMAALEGQDPSGLQLGLTEALHFVAAAWQAVEPSDIAACFREAGFGGGPN

ATITTSLKSEGEEEEEEEEEEEEEEGEGEEEEEEGEEEEEEGGEGEELGEEEEVEEEGDVDSDEEEEEDEESSSEG

LEAEDWAQGVVEAGGSFGAYGAQEEAQCPTLHFLEGGEDSDSDSEEEDDEEEDDEDEDDDDDEEDGD

EVPVPSFGEAMAYFAMVKRYLTSFPIDDRVQSHILHLEHDLVHVTRKNHARQAGVRGLGHQS

 

Applications

Standard ELISA test, line/dot assay and microarray assay with positive/negative sera panels.

 

Formulation

Lyophilized at 1 mg/mL in storage buffer (20mM Tris, 300-500mM NaCl, 10% Glycerol, PH8.0).

 

Reconstitution

Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the

lyophilized pellet dissolve completely.

 

Storage

Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.  Avoid

repeated freezing /thawing cycles.

 

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

 

SDS-PAGE Gel

 

 

 

 

Contact Us

 

Address:

 

5/F, Biotech Centre 2, No. 11 Science Park West Avenue, 

Hong Kong Science Park, Shatin, N.T., Hong Kong

Email: 

info@immunodiagnostics.com.hk      sales@immunodiagnostics.com.hk

Phone:

(+852) 3502 2780    

Fax:  

(+852)  3502 2781

Write a review

Your Name:


Your Review: Note: HTML is not translated!

Rating: Bad           Good

Enter the code in the box below:



Tags: CENPB