Home » Search » Recombinant Human Fatty Acid Binding Protein 4 (hFABP4)

Recombinant Human Fatty Acid Binding Protein 4 (hFABP4)

Product Code: 41030

 

Type:

Recombinant

Cat. No.:

41030

Tag:

N-terminal 6xHis tag

Size:

0.1 mg

Source:

E.Coli

Purity:

>95%

Other names:

aP2; A-FABP;

Species:

Human

 

For bulk order or without FedEx acc, please contact us by email
Payable FedEx acc:

 

INTRODUCTION

 

FABP-4, also termed adipocyte fatty-acid binding protein (A-FABP) or AP2, has been shown to play a key role in obesity and metabolic syndrome. A-FABP knockout mice are substantially protected from insulin resistance, dyslipidemia, type 2 diabetes and fatty liver disease, despite of increased adipocity.
In clinical studies, increased circulating A-FABP levels are found in obese subjects and associated with non-alcoholic fatty liver disease, stroke, and carotid atherosclerosis.

 

Description


Total 160 AA. Mw: 18 kDa (calculated). N-terminal His-tag and TEV cleavage site,

28 extra AA (highlighted).

 

Amino Acid Sequence

 

MSYYHHHHHHDYDIPTTENLYFQGAMGSMCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAG

MAKPNMIISVNGDVITIKSESTFKNTEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIK

RKREDDKLVVECVMKGVTSTRVYERA
 

Formulation


Lyophilized in 1 mg/mL in PBS.

 

Reconstitution


Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the

lyophilized pellet dissolve completely.

 

Storage


Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.  Avoid

repeated freezing /thawing cycles.

 

Applications


ELISA and Western blotting.

 

Quality Control Test

BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein.

 

SDS-PAGE Gel

 

 

 

 

Contact Us

 

Address:

 

5/F, Biotech Centre 2, No. 11 Science Park West Avenue,

Hong Kong Science Park, Shatin, N.T., Hong Kong

Email:

info@immunodiagnostics.com.hk      sales@immunodiagnostics.com.hk

Phone:

(+852) 3502 2780

Fax:

(+852)  3502 2781

Write a review

Your Name:


Your Review: Note: HTML is not translated!

Rating: Bad           Good

Enter the code in the box below: