Home » Search » Recombinant Human Fatty Acid Binding Protein 5 (hFABP5)

Recombinant Human Fatty Acid Binding Protein 5 (hFABP5)

Product Code: 41040

 

Type:

Recombinant

Cat. No.:

41040

Tag:

His

Size:

0.1 mg

Source:

E.Coli

Purity:

>95%

Other names:

E-FABP; PA-FABP

Species:

Human

 

For bulk order or without FedEx acc, please contact us by email
Payable FedEx acc:

 

Introduction to the Molecule

The fatty-acid-binding proteins (FABPs) are a family of carrier proteins for fatty acids and other

lipophilic substances such as eicosanoids and retinoids. These proteins are thought to facilitate

the transfer of fatty acids between extra- and intracellular membranes. The fatty acid binding

protein 4 (FABP-4) and fatty acid binding protein 5(FABP5) are closely related and both are

expressed in adipocytes. Mice with targeted disruption of FABP-4 accompany FABP-5 almost

completely protect against diet-induced obesity, insulin resistance, dyslipidemia, type 2 diabetes,

and fatty liver disease. While mice over expressing FABP5 in adipose have reduced insulin sensitivity.

 

Description

Total 162 AA.  Mw: 18.4 kDa (calculated). N-terminal His-tag and TEV cleavage site,

28 extra AA (highlighted).

 

Amino Acid Sequence

MSYYHHHHHHDYDIPTTENLYFQGAMGSATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAM

AKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRK

LKDGKLVVECVMNNVTCTRIYEKVE

 

Formulation

Filtered (0.22 μm) and lyophilized in 1 mg/mL in PBS.

 

Reconstitution

Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let

the lyophilized pellet dissolve completely.

 

Storage

Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.  Avoid

repeated freezing /thawing cycles.

 

Applications

Western blotting

 

Quality Control Test

BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein.

 

SDS-PAGE Gel

 

 

 

 

Contact Us

 

Address:

 

5/F, Biotech Centre 2, No. 11 Science Park West Avenue,

Hong Kong Science Park, Shatin, N.T., Hong Kong

Email:

info@immunodiagnostics.com.hk      sales@immunodiagnostics.com.hk

Phone:

(+852) 3502 2780

Fax:

(+852)  3502 2781

Write a review

Your Name:


Your Review: Note: HTML is not translated!

Rating: Bad           Good

Enter the code in the box below:



Tags: hFABP5