Home » Search » Recombinant Human Fibroblast Growth Factor-21 with His-tag

Recombinant Human Fibroblast Growth Factor-21 with His-tag

Product Code: 41184

Type:

Recombinant

Cat. No.:

41184

Tag:

His

Size:

0.1 mg

Source:

E.Coli

Purity:

>95%

Other names:

FGF21

Species:

Human

 

For bulk order or without FedEx acc, please contact us by email
Payable FedEx acc:

 

Introduction to the Molecule

FGF21, a polypeptide with 210 amino acid residues produced mostly from the liver tissue.[1]

Mouse FGF21 shares 75% identity as human FGF21. Recent animal studies indicate it possesses

potent beneficial effects on glucose and lipid metabolism and insulin sensitivity.[2] Increasing

data shows FGF21 can significantly stimulate glucose uptake in mature adipocytes. And The

lowered LDL-cholesterol and increased HDL-cholesterol can also be observed.[2,3] FGF21 exerts

its bioactivity through interaction with membrane bound FGF receptors (FGFRs) which requires

β-Klotho as a co-factor to bind and activate FGFR signaling.[4,5]The activation of FGF21 can

induce the stimulation of diverse downstream pathways medicated by MAPK,FRS-2, SHP-2,

PI3K, raf, stat and other signaling molecules.[6-9] In sum, FGF21 induces a variety of significant

beneficial metabolic changes without apparent adverse effects which makes this factor a hot

candidate to treat some metabolic diseases.[10]

 

Description

Total 206AA Mw: 22.5kDa (calculated). N-terminal His-tag and TEV cleavage site,

25extra AA (highlighted).

 

Amino Acid Sequence

MSYYHHHHHHDYDIPTTENLYFQGAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDG

TVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVY

QSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQ

GRSPSYAS

 

Formulation

Lyophilized in 1 mg/mL in PBS.

 

Reconstitution

Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let

the lyophilized pellet dissolve completely.

 

Storage

Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.  Avoid

repeated freezing /thawing cycles.

 

Applications


ELISA and Western blotting.

 

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

 

SDS-PAGE Gel  

 

 

Reference:

 

 

 

[1] Nishimura T, Nakatake Y, Konishi M, Itoh N: Identification of a novel FGF, FGF-21, preferentially

expressed in the liver. Biochim Biophys Acta1492:203–206, 2000

[2] Kharitonenkov A et al. FGF-21 as a novel metabolic regulator. J Clin Invest 115:1627–1635, 2005

[3]Alexei Kharitonenkov et al. The Metabolic State of Diabetic Monkeys Is Regulated by Fibroblast

Growth Factor-21.Endocrinology .148(2):774–781. 2007

[4] Hiroshi Kurosu et al. Tissue-specific Expression of βKlotho and Fibroblast Growth Factor (FGF)

Receptor Isoforms Determines Metabolic Activity of FGF19 and FGF21.

J Biol Chem. 282(37): 26687–26695. 2007

[5] Ogawas Y et al.  BetaKlotho is required for metabolic activity of fibroblast growth factor 21

Proc Natl Acad Sci USA 104: 7432-7437, 2007.

[6]Steven L. PELECH et al. Fibroblast growth factor treatment of Swiss 3T3 cells activates a

subunit S6 kinase that phosphorylates a synthetic peptide substrate. Proc. Natl. Acad. Sci. USA

Vol. 83, pp. 5968-5972, August 1986

[7]Rosa Carballada et al. Phosphatidylinositol-3 kinase acts in parallel to the ERK MAP kinase in

the FGF pathway during Xenopus mesoderm induction. Development 128, 35-44 (2001)

[8]Dayanand D. Deo et al. Phosphorylation of STAT-3 in Response to Basic Fibroblast Growth

Factor Occurs through a Mechanism Involving Platelet-activating Factor, JAK-2, and Src in Human

Umbilical Vein Endothelial Cells. The journal of molecular chemistry. Vol. 277, No. 24, Issue of

June 14, pp. 21237–21245, 2002

[9]Maria I. Kontaridis et al. Role of SHP-2 in Fibroblast Growth Factor Receptor-Mediated

Suppression of Myogenesis in C2C12 Myoblasts. Molecular and cellular biology, Vol. 22,

No. 11, p. 3875–3891. 2002

[10] Dostálová I, Haluzíková D, Haluzík M.Fibroblast Growth Factor 21: A Novel Metabolic

Regulator With Potential Therapeutic Properties in Obesity/Type 2 Diabetes Mellitus. Physiol.

Res. 58: 1-7, 2009

 

 

 

 

Contact Us

 

Address:

 

5/F, Biotech Centre 2, No. 11 Science Park West Avenue,

Hong Kong Science Park, Shatin, N.T., Hong Kong

Email:

info@immunodiagnostics.com.hk      sales@immunodiagnostics.com.hk

Phone:

(+852) 3502 2780

Fax:

(+852)  3502 2781

Write a review

Your Name:


Your Review: Note: HTML is not translated!

Rating: Bad           Good

Enter the code in the box below:



Tags: his-hFGF21