top of page
EPO, Human

EPO, Human

SKU: UA040004

★ Download Datasheet PDF ★

★ Download MSDS ★

 

 Species:

Human

Expression System:

CHO

MW:

28-40 kDa (reducing)

Accession:

P01588

Cat No.

UA040004

Endotoxin:

0.1 EU/μg

Purity:

>95% as determined by SDS-PAGE

  • INTRODUCTION

    Erythropoietin (EPO) is a glycoprotein hormone that is principally known for its role in erythropoiesis, where it is responsible for stimulating proliferation and differentiation of erythroid progenitor cells. It is a secreted, glycosylated cytokine composed of four alpha helical bundles. Physiological levels of EPO in adult mammals are maintained primarily by the kidneys, whereas levels in fetal or neonatal mammals are maintained by the liver. EPO also can exert various non-hematopoietic activities, including vascularization and proliferation of smooth muscle, neural protection during hypoxia, and stimulation of certain B cells.

  • Amino Acid Sequence

    APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

  • Physical Appearance:

    Lyophilized powder

  • Buffer:

    PBS, pH 7.4

  • Reconstitution:

    Reconstitute at less than 1 mg/ml according to the size in ultrapure water after rapid centrifugation.

  • Stability and Storage

    • 12 months from date of receipt, -20 to -70 °C as supplied.
    • 6 months, -20 to -70 °C under sterile conditions after reconstitution.
    • 1 week, 2 to 8 °C under sterile conditions after reconstitution.

    Note: Please avoid repeated freeze-thaw cycles

$999.00Price

The currency used on this website is United States Dollars (USD). All prices are displayed and transactions are processed in USD. For orders outside Hong Kong or if you would like to have other currencies available, please contact us for a quote.

bottom of page