Human Proteinase 3 (PR3)
Expressed in CHO cells with total 264 AA. Mw: 29 KDa (calculated).
C-terminal 10xHis-tag, 10 extra AA (highlighted).
Recombinant antigen for research use or manufacturing only.
Type: | Recombinant | Cat. No.: | 41A291 |
Tag: | C-terminal 10xHis | Size: | 0.1 mg |
Source: | Chinese hamster ovary cells | Purity: | >95% |
Other names: | Myeloblastin | Species: | Human |
INTRODUCTION
Antineutrophil cytoplasmic antibody (ANCA)-associated vasculitis (AAV) is a rare autoimmune disease with increasing annual incidence, recently estimated at 20 per million per year. It is associated with antibodies to proteinase 3 or myeloperoxidase and is generally considered as a disease affecting small blood vessels (‘small vessel vasculitis’). PR3 antibodies are most commonly associated with granulomatous polyangiitis (GPA), with peak incidence in 50 to 70 years old and affecting more men than women. Thus, PR3-ANCAs are well-known serological markers for diagnosis of GPA.
FORMULATION
Liquid in PBS. (137mM NaCl, 2.7mM KCl, 100mM Na2HPO4, 1.5mM KH2PO4, pH 7.4).
APPLICATION/ USAGE
Standard ELISA test, line/dot assay and microarray assay with positive/negative sera panels.
STORAGE
Store at -20°C to -80°C upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage. Avoid repeated freezing/thawing cycles.
AMINO ACID SEQUENCE
MAHRPPSPALASVLLALLLSGAARAIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDAGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLRRVEAKGRPHHHHHHHHHH