top of page
M-CSF, Human

M-CSF, Human

SKU: UA040016

★ Download Datasheet PDF ★

★ Download MSDS ★

 Species:

Human

Expression System:

CHO

MW:

16-23 kDa (reducing)

Accession:

P09603-3

Cat No.

UA040016

Endotoxin:

0.1 EU/μg

Purity:

>95% as determined by SDS-PAGE

 

  • INTRODUCTION

    Macrophage colony-stimulating factor (M-CSF) is a hematopoietic growth factor that regulates the proliferation, differentiation, and functional activation of monocytes. Normally detected in human serum, M-CSF plays an important role in enhancing the effector functions of mature monocytes and macrophages. The role of M-CSF is not only restricted to the monocyte/macrophage cell lineage. By interacting with its membrane receptor (CSF1R or M-CSF-R encoded by the c-fms proto-oncogene), M-CSF also modulates the proliferation of earlier hematopoietic progenitors and influence numerous physiological processes involved in immunology, metabolism, fertility and pregnancy.

  • Amino Acid Sequence

    Glu33-Ser190
    EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS

     

  • Physical Appearance:

    Lyophilized powder

  • Buffer:

    PBS, pH 7.4

  • Reconstitution:

    Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

  • Stability and Storage

    • 12 months from date of receipt, -20 to -70 °C as supplied.
    • 6 months, -20 to -70 °C under sterile conditions after reconstitution.
    • 1 week, 2 to 8 °C under sterile conditions after reconstitution.

    Note: Please avoid repeated freeze-thaw cycles

$999.00Price

The currency used on this website is United States Dollars (USD). All prices are displayed and transactions are processed in USD. For orders outside Hong Kong or if you would like to have other currencies available, please contact us for a quote.

bottom of page