The fatty acid binding proteins (FABPs) are a family of carrier proteins for fatty acids and other lipophilic substances such as eicosanoids and retinoids. These proteins are thought to facilitate the transfer of fatty acids between extra- and intracellular membranes. The fatty acid binding protein 4 (FABP-4) and fatty acid binding protein 5(FABP5) are closely related and both are expressed in adipocytes. Mice with targeted disruption of FABP-4 accompany FABP-5 almost completely protect against diet-induced obesity, insulin resistance, dyslipidemia, type 2 diabetes, and fatty liver disease. While mice over expressing FABP5 in adipose have reduced insulin sensitivity.

Total 162 AA. Mw: 18.4 kDa (calculated).

N-terminal His-tag and TEV cleavage site, 28 extra AA (highlighted).

MSYYHHHHHHDYDIPTTENLYFQGAMGSATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.  Avoidrepeated freezing /thawing cycles.

Add deionized water to prepare a working stock solution of approximately 1 mg/mL and letthe lyophilized pellet dissolve completely.

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

Filtered (0.22 μm) and lyophilized in 1 mg/mL in PBS.

Western blotting